PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_26439
Common NameKK1_026407
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family SRS
Protein Properties Length: 304aa    MW: 32090.1 Da    PI: 6.8236
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_26439genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702210.44.7e-65792453154
         DUF702   3 sgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaaeaaskrkrelkskkqsalsstklssaeskk 98 
                    s +++CqdCGnqakkdC+h+RCRtCCksrgfdCathvkstWvpaa+rrerq ++ +a+  ++   +++ +k+ r   s++++++++++ +++++++
  C.cajan_26439  79 SAGSTCQDCGNQAKKDCSHRRCRTCCKSRGFDCATHVKSTWVPAARRRERQLMAVTAAVGST--GSTSGAKKARIVASQTTTTSHTSTSNNTTPPR 172
                    56789*********************************************877766655554..46677777887755666665556666777889 PP

         DUF702  99 eletss.................lPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                    +++t s                 lP +v+++avf+cvrv++vddge+e+aYq++v+igGhvfkG+LydqG+e+
  C.cajan_26439 173 SFDTGSshqgfvescadvgfkesLPCQVRAPAVFKCVRVTAVDDGEDEYAYQAVVKIGGHVFKGFLYDQGTEA 245
                    99998899**************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051421.4E-6081244IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016235.6E-2783125IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016243.3E-29196242IPR006511Lateral Root Primordium type 1, C-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MWPGASRSFN YNLAPHHDIY VVAPASSFHH HNDAVLSDPN NGSGTNSTAL GVNVIQLWQD  60
QESPPPQQQQ HVEHEASGSA GSTCQDCGNQ AKKDCSHRRC RTCCKSRGFD CATHVKSTWV  120
PAARRRERQL MAVTAAVGST GSTSGAKKAR IVASQTTTTS HTSTSNNTTP PRSFDTGSSH  180
QGFVESCADV GFKESLPCQV RAPAVFKCVR VTAVDDGEDE YAYQAVVKIG GHVFKGFLYD  240
QGTEAEDKEG YPNISELHLG GNVATASDGG GGRNGSPMLD PSEVYAASGG GLLGGSSNYG  300
NPIN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150381e-94AP015038.1 Vigna angularis var. angularis DNA, chromosome 5, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007146319.11e-147hypothetical protein PHAVU_006G030400g
SwissprotQ94CK99e-78LRP1_ARATH; Protein LATERAL ROOT PRIMORDIUM 1
TrEMBLA0A151SAF20.0A0A151SAF2_CAJCA; Uncharacterized protein
STRINGGLYMA07G35780.21e-131(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF65043351
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12330.21e-72Lateral root primordium (LRP) protein-related